PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G174200.1
Common NamePHAVU_001G174200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 291aa    MW: 32482.1 Da    PI: 10.2581
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G174200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.5e-142670147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +W++eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  Phvul.001G174200.1 26 RESWSEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 70
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.26E-172076IPR009057Homeodomain-like
PROSITE profilePS5129415.8492175IPR017930Myb domain
TIGRFAMsTIGR015573.0E-182473IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-62476IPR009057Homeodomain-like
SMARTSM007172.2E-112573IPR001005SANT/Myb domain
PfamPF002491.5E-112670IPR001005SANT/Myb domain
CDDcd001674.49E-92871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAMAPSTPSS GSGKKVRKPY TITKSRESWS EEEHDKFLEA LQLFDRDWKK IEDFVGSKTV  60
IQIRSHAQKY FLKVQKNGTV AHVPPPRPKR KAAHPYPQKA FKNVLVPLPA SLAYVSSTST  120
PPPGYATWDE KFLLMNSGSN KSLPYQDELT NLHGDEADIG SKGVTIIGRS CLSGVGNSTR  180
KLSATEMPKQ GKQTQVLHGL PDFAEVYSFI GSIFDPDTKG HVQKLKEMDP INFETVLLLM  240
KNLTLNLSSP DFVPVRNAIS SYDANAEFRR QKLMSRNRQT TNHVKQLNKH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162715.10.0hypothetical protein PHAVU_001G174200g
SwissprotQ8RWU31e-128RVE8_ARATH; Protein REVEILLE 8
TrEMBLV7CX840.0V7CX84_PHAVU; Uncharacterized protein
STRINGGLYMA19G36170.11e-168(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67353449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-104MYB_related family protein